Pseudomonas protegens Pf-5: PFL_1797 Help Entry PFL_1797          CDS       T00249                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfl  Pseudomonas protegens Pf-5 Pathway pfl00998   Biosynthesis of various antibiotics pfl01100   Metabolic pathways pfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PFL_1797 (acpP)    00074 Mycolic acid biosynthesis     PFL_1797 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PFL_1797 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AAY91086 UniProt:  Q4KFR6 LinkDB All DBs Position 1999684..1999920 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgctgagcaactgggcgttaaagaa gaagaagttgttaacaccgcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gaaaagatcactaccgttcaagcagctatcgactacgttaccagccaccaggcttaa

DBGET integrated database retrieval system