Pseudomonas protegens Pf-5: PFL_4484 Help Entry PFL_4484          CDS       T00249                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pfl  Pseudomonas protegens Pf-5 Pathway pfl02020   Two-component system pfl02025   Biofilm formation - Pseudomonas aeruginosa pfl02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pfl00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PFL_4484  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     PFL_4484   09142 Cell motility    02040 Flagellar assembly     PFL_4484  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pfl02035]     PFL_4484 Bacterial motility proteins [BR:pfl02035]  Flagellar system   Flagellar assembly proteins    Others     PFL_4484 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AAY93735 UniProt:  Q4K861 LinkDB All DBs Position 5196351..5196668 Genome browser AA seq 105 aa AA seqDB search MVIDFSRLNSSPSLTGSTRTSTSKETGDAGKSTPLTTAAETSKSGESVHLSNEAQQLQKV TDKLRDQPAVDKARVAELKQAIADGSYKVDSNRVASKLLNFEAQR NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtcatcgacttcagccgtttaaacagctccccttcactgacaggcagtacgcgtacc agcaccagcaaggaaaccggtgatgccggcaaatccacgccgctgacaaccgccgccgag accagcaaaagcggggaatcggtacacctgagcaatgaggctcaacagttgcagaaagtc actgacaagctgcgcgatcagcctgccgtcgacaaagcccgggtggccgagttgaagcaa gcgattgccgatggcagctataaggtcgacagcaaccgcgtagccagcaaactgcttaac ttcgaagcccagcgttag

DBGET integrated database retrieval system