Pseudomonas protegens Pf-5: PFL_4839 Help Entry PFL_4839          CDS       T00249                                  Symbol groS Name (GenBank) chaperonin GroS   KO K04078   chaperonin GroES Organism pfl  Pseudomonas protegens Pf-5 Brite KEGG Orthology (KO) [BR:pfl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pfl03110]     PFL_4839 (groS)    03029 Mitochondrial biogenesis [BR:pfl03029]     PFL_4839 (groS) Chaperones and folding catalysts [BR:pfl03110]  Heat shock proteins   HSP10    PFL_4839 (groS) Mitochondrial biogenesis [BR:pfl03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PFL_4839 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AAY94069 UniProt:  Q4K763 LinkDB All DBs Position complement(5584107..5584400) Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEESKTAGGIVLPGSAAEKPNRGEIVAVGTGRVLDNGEVRALAVK VGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVIEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgaccgcgtcgtcatccgtcgcagcgaagaagaatcgaaa actgccggcggtatcgttctgcctggttcggctgctgaaaaacctaaccgtggcgaaatc gtcgctgtaggtaccggccgtgtgctggacaacggtgaagtacgtgcgctggccgtgaaa gtgggtgacaaagtggtgtttggcccgtactccggcagcaacaccgtgaaagtcgatggc gaagatctgctggtaatggccgagaacgagattctcgctgttatcgaaggctga

DBGET integrated database retrieval system