Phytohabitans flavus: Pflav_058950 Help Entry Pflav_058950      CDS       T06516                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism pfla  Phytohabitans flavus Pathway pfla00190   Oxidative phosphorylation pfla01100   Metabolic pathways Module pfla_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pfla00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Pflav_058950 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pfla00194]     Pflav_058950 (atpE) Photosynthesis proteins [BR:pfla00194]  Photosystem and electron transport system   F-type ATPase [OT]    Pflav_058950 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF4233 Motif Other DBs NCBI-ProteinID:  BCB79485 UniProt:  A0A6F8Y083 LinkDB All DBs Position complement(6403672..6403899) Genome browser AA seq 75 aa AA seqDB search MPLLAEVTGSTAAIGYGLAAIGPGIGVGLIFASYVQATARQPESSRLTQPFVWIGFAVVE ALALLGVAFGFIWAG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgccactgctcgctgaggtaacgggcagcaccgccgccatcggctacggcctggccgcc atcggcccgggtatcggcgtcggcctgatcttcgccagctacgtgcaggcgaccgcgcgc cagccggagtcgtcccgcctgacgcagccgttcgtctggatcggcttcgccgtggtcgag gcgctcgccctgctgggtgtcgcgttcggcttcatctgggctggctga

DBGET integrated database retrieval system