Ptychodera flava: 139117636 Help Entry 139117636         CDS       T10724                                  Name (RefSeq) uncharacterized protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pfll  Ptychodera flava Pathway pfll04145   Phagosome pfll04148   Efferocytosis pfll04310   Wnt signaling pathway pfll04517   IgSF CAM signaling pfll04518   Integrin signaling pfll04620   Toll-like receptor signaling pathway pfll05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pfll00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     139117636   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     139117636    04518 Integrin signaling     139117636  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     139117636    04148 Efferocytosis     139117636  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     139117636  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     139117636  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfll04131]     139117636   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfll04147]     139117636    04031 GTP-binding proteins [BR:pfll04031]     139117636 Membrane trafficking [BR:pfll04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     139117636  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     139117636   Macropinocytosis    Ras GTPases     139117636  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     139117636 Exosome [BR:pfll04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    139117636   Exosomal proteins of other body fluids (saliva and urine)    139117636   Exosomal proteins of colorectal cancer cells    139117636   Exosomal proteins of bladder cancer cells    139117636 GTP-binding proteins [BR:pfll04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     139117636 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc ThiF Motif Other DBs NCBI-GeneID:  139117636 NCBI-ProteinID:  XP_070536979 LinkDB All DBs Position 18:complement(18592843..18595878) Genome browser AA seq 139 aa AA seqDB search MNFSHEELQKMQNLKMTVVGYGAVGMSCLLVAYNTGSFPADNVPTVFDNYYANTMVDGKP YSIAFFDTAGQVDRQVNSKQLIMSAISRTKAPCTNTSGGGGAGELPGDLKISRISEQVAL SVITEQRMKKAWKLPKEME NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgaatttcagtcatgaagaactgcagaaaatgcaaaacctgaagatgaccgtggtcggt tatggtgcagttggtatgagctgtcttctagtagcctacaacaccggctccttccccgcg gacaatgtgcccaccgtttttgacaattattatgctaataccatggtagatggaaaacca tacagcattgcattttttgacactgctgggcaggtggacagacaagtcaacagcaaacag ctcatcatgtctgcaatttcaaggactaaggctccatgcacaaatacttctggaggggga ggggcgggagaattgccgggggatttgaaaatatcaaggatctcagaacaagtggcactc tcagtcatcacagaacaacggatgaaaaaggcctggaagttgccaaaagaaatggaatga

DBGET integrated database retrieval system