Ptychodera flava: 139125947 Help Entry 139125947         CDS       T10724                                  Name (RefSeq) claudin-11-like   KO K06087   claudin Organism pfll  Ptychodera flava Pathway pfll03272   Virion - Hepatitis viruses pfll04382   Cornified envelope formation Brite KEGG Orthology (KO) [BR:pfll00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     139125947  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     139125947  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pfll03037]     139125947    04147 Exosome [BR:pfll04147]     139125947 Cilium and associated proteins [BR:pfll03037]  Other cilia and associated proteins   Stereociliary proteins    139125947 Exosome [BR:pfll04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    139125947   Exosomal proteins of colorectal cancer cells    139125947 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF4267 Motif Other DBs NCBI-GeneID:  139125947 NCBI-ProteinID:  XP_070548124 LinkDB All DBs Position 3:complement(10138432..10139359) Genome browser AA seq 111 aa AA seqDB search MLSPVLAVTGFAASCTAVLLYVICTASDAWLVTTYPQRTNTGLWRHCVDETGCVALGVHN IAAYVHIARALMISACIVGGFAVMLYAVFVRKSFNEKSIIASCTVIAFSGE NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgctatcaccggtcttagcggtgacagggttcgcggcgtcgtgtacagctgtgctcctc tacgtcatatgcacggccagtgacgcgtggctggtgacgacgtatccgcagcgaacgaac acgggtctgtggaggcactgtgtcgacgagacggggtgtgtggctctcggagtccacaac atcgcagcatacgttcacatagccagggcattaatgataagtgcgtgtatcgtgggaggt tttgcagtcatgttgtatgccgtgttcgtcaggaagtccttcaatgagaaatccatcata gcgtcatgcacagtcattgcgttttctggtgagtaa

DBGET integrated database retrieval system