Ptychodera flava: 139133363 Help Entry 139133363         CDS       T10724                                  Name (RefSeq) calmodulin-like isoform X1   KO K02183   calmodulin Organism pfll  Ptychodera flava Pathway pfll04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:pfll00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     139133363  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pfll01009]     139133363   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfll04131]     139133363    03036 Chromosome and associated proteins [BR:pfll03036]     139133363   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfll04147]     139133363 Protein phosphatases and associated proteins [BR:pfll01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      139133363 Membrane trafficking [BR:pfll04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     139133363 Chromosome and associated proteins [BR:pfll03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      139133363 Exosome [BR:pfll04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    139133363 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EFhand_Ca_insen FCaBP_EF-hand Dockerin_1 EH DUF7151 DUF5956 Motif Other DBs NCBI-GeneID:  139133363 NCBI-ProteinID:  XP_070556020 LinkDB All DBs Position 5:25434312..25457168 Genome browser AA seq 117 aa AA seqDB search MGCTSSSNKMKNRRWVSGPYTSQTTETTTLTTTTQNQGSPCKEKFTREDILLIFKAMDKD GNGYLTADEIRQTLVETKAYENEEQVQKMITEADRDGDGRINYLEFTGVMDFVNSKP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgggatgcacatcgagttcaaataagatgaaaaacaggagatgggtatcaggtccttac acgagtcaaactacagaaaccacgacgttgacgacgacgacacaaaaccaaggctcaccg tgtaaagaaaaattcaccagggaagatattttactcattttcaaagccatggacaaggac ggcaacgggtacttgactgccgatgaaattaggcagactctggttgaaaccaaagcgtat gagaacgaagaacaggttcagaaaatgatcacggaagctgacagggacggcgatggtcga ataaattacctggagttcactggtgttatggacttcgtcaattcaaaaccatag

DBGET integrated database retrieval system