Ptychodera flava: 139144802 Help Entry 139144802         CDS       T10724                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pfll  Ptychodera flava Pathway pfll04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pfll00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     139144802  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pfll04121]     139144802    03400 DNA repair and recombination proteins [BR:pfll03400]     139144802 Ubiquitin system [BR:pfll04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      139144802    Cul5 complex      139144802 DNA repair and recombination proteins [BR:pfll03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      139144802 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  139144802 NCBI-ProteinID:  XP_070571681 LinkDB All DBs Position 12:6138761..6145400 Genome browser AA seq 121 aa AA seqDB search MDVFLMVRRKKTTIFTDAKETTTVYELKKIVEGITKKPPEDQRLFKEDQILEDTKTLGDC GFTSSTARAQAPATVGLAFKEGEEDFEGLEVTPYSNPPELPDVMKPQESSTSNAAEQQPV S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttttgatggtccgccgtaagaagaccaccattttcaccgatgcaaaagaa accacaaccgtctatgagttgaagaaaattgttgaaggaatcacaaagaaaccacccgaa gatcagcgactatttaaagaagatcaaattttagaagacacaaaaactttaggagattgt gggtttaccagcagcactgcaagggctcaggcaccagctacagttggattagcattcaaa gaaggtgaagaagactttgaaggattggaggtcacaccctactccaatccaccagaatta cccgatgttatgaaacctcaagagtcaagcacatcaaacgccgcggagcagcaaccagta tcttaa

DBGET integrated database retrieval system