Perca fluviatilis (European perch): 120550752 Help Entry 120550752         CDS       T11622                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pflt  Perca fluviatilis (European perch) Pathway pflt04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pflt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120550752  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pflt04121]     120550752    03400 DNA repair and recombination proteins [BR:pflt03400]     120550752 Ubiquitin system [BR:pflt04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      120550752    Cul5 complex      120550752 DNA repair and recombination proteins [BR:pflt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120550752 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD LED_rpt Motif Other DBs NCBI-GeneID:  120550752 NCBI-ProteinID:  XP_039643473 LinkDB All DBs Position 21:16288025..16293284 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLYKDDQSLEDSKTLGDC GFTNQTARPQAPATIGLAFRINDDLFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tctaccactgtgtatgagctaaagcgtattgttgaaggaatccttaagagagcacctgaa gaccagaggctgtacaaagatgaccagtcgctagaggacagcaaaactcttggtgactgt ggatttaccaaccagactgccagacctcaagccccagctacaattggtctggccttccgc attaatgatgacctgttcgaacagctgcacatcgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactccggtagcactgccaatgaacaggctgtgcagtga

DBGET integrated database retrieval system