Plantibacter flavus: BWO91_09075 Help Entry BWO91_09075       CDS       T10223                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pflu  Plantibacter flavus Pathway pflu01100   Metabolic pathways pflu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pflu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BWO91_09075    00074 Mycolic acid biosynthesis     BWO91_09075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BWO91_09075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AQX80113 UniProt:  A0A1S7B8W6 LinkDB All DBs Position complement(1911384..1911632) Genome browser AA seq 82 aa AA seqDB search MALSTEEVLAGLAELINDETGIATDTVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVDFIVKAQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagtcctcgccggcctggccgagctgatcaacgacgagacc ggcatcgcgaccgacaccgtcgagctggacaagtcgttcaccgacgacctcgacatcgac tcgatctccatgatgaccatcgtcgtcaacgcggaggagaagttcgacgtgaagatcccg gacgaagaggtcaagaacctgaagaccgtcggcgacgccgtcgacttcatcgtcaaggct cagggctag

DBGET integrated database retrieval system