Plantibacter flavus: BWO91_13900 Help Entry BWO91_13900       CDS       T10223                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism pflu  Plantibacter flavus Pathway pflu03060   Protein export pflu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pflu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BWO91_13900  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     BWO91_13900  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pflu02044]     BWO91_13900 Secretion system [BR:pflu02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    BWO91_13900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AQX80912 LinkDB All DBs Position complement(2970985..2971164) Genome browser AA seq 59 aa AA seqDB search MGFLQNLTGWHALIVLAVILLFFGAAKLPSLARSVGQSARILKDEVSADTDPRADTPAA NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgggattcctccagaacctcaccggctggcacgccctcatcgtcctcgccgtcatcctg ctgttcttcggtgccgcgaagctcccgagcctcgcccgcagcgtcgggcagtcggcacgc atcctgaaggacgaggtgtcggccgacaccgacccccgcgccgacactccggctgcctga

DBGET integrated database retrieval system