Perca flavescens (yellow perch): 114546799 Help Entry 114546799         CDS       T07494                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pflv  Perca flavescens (yellow perch) Brite KEGG Orthology (KO) [BR:pflv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pflv03041]     114546799 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pflv04052]     114546799 (ubl5) Spliceosome [BR:pflv03041]  Complex B   Other components    Complex B specific factors     114546799 (ubl5) Cytokines and neuropeptides [BR:pflv04052]  Neuropeptides   Unclassified    114546799 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  114546799 NCBI-ProteinID:  XP_028421669 LinkDB All DBs Position 2:complement(12522326..12525576) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRFDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtttgcaacgatcgcctgggcaagaaagtccgggtcaagtgcaactct gaggataccattggcgatctaaagaagctcattgctgcccagacaggaactcgatttgac aaaattgtgcttaagaaatggtataccattttcaaggaccacgtgtctctcggtgactat gaaatccatgatgggatgaacctggaactctactaccagtag

DBGET integrated database retrieval system