Perca flavescens (yellow perch): 114548231 Help Entry 114548231         CDS       T07494                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pflv  Perca flavescens (yellow perch) Pathway pflv04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pflv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114548231  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pflv04121]     114548231    03400 DNA repair and recombination proteins [BR:pflv03400]     114548231 Ubiquitin system [BR:pflv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114548231    Cul5 complex      114548231 DNA repair and recombination proteins [BR:pflv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114548231 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD LED_rpt Motif Other DBs NCBI-GeneID:  114548231 NCBI-ProteinID:  XP_028423849 LinkDB All DBs Position 21:15375766..15379586 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLYKDDQSLEDSKTLGDC GFTNQTARPQAPATIGLAFRINDDMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tctaccactgtgtatgagctgaagcgtattgttgaaggaatccttaagagagcacctgaa gaccagaggctgtacaaagatgaccagtcgctagaggacagcaaaactcttggtgactgt ggatttaccaaccagactgccagacctcaagccccagctacaattggtctggccttccgc attaatgatgacatgttcgaacagctgcacatcgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactccggtagcactgccaatgaacaggctgtgcagtga

DBGET integrated database retrieval system