Perca flavescens (yellow perch): 114552169 Help Entry 114552169         CDS       T07494                                  Symbol uxt Name (RefSeq) protein UXT   KO K26537   protein UXT Organism pflv  Perca flavescens (yellow perch) Brite KEGG Orthology (KO) [BR:pflv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pflv03036]     114552169 (uxt)    03029 Mitochondrial biogenesis [BR:pflv03029]     114552169 (uxt) Chromosome and associated proteins [BR:pflv03036]  Eukaryotic type   Histone modification proteins    Other histone modification proteins     114552169 (uxt) Mitochondrial biogenesis [BR:pflv03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     114552169 (uxt) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prefoldin CREPT CpxA_peri Fib_alpha Motif Other DBs NCBI-GeneID:  114552169 NCBI-ProteinID:  XP_028428604 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MAPPVDENANANANLDQKVLQYENFINEVLKRDLQKVMEQRDSVYEKISQYLQLKNTIQS LQESGLQQLKTDVDLGCNFFVQAEV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctccgcctgttgatgagaatgctaatgctaatgctaacctggaccagaaggttctg cagtacgaaaacttcatcaacgaagttctgaagagagatttacagaaggtgatggagcag agagactcagtttatgagaagatctctcagtatcttcagctgaagaacaccatacagagt ctgcaggagtcgggcctccagcagctgaagacagacgtagatctcggctgtaacttcttc gtccaggctgaagtgtga

DBGET integrated database retrieval system