Perca flavescens (yellow perch): 114559784 Help Entry 114559784         CDS       T07494                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism pflv  Perca flavescens (yellow perch) Pathway pflv04010   MAPK signaling pathway pflv04012   ErbB signaling pathway pflv04068   FoxO signaling pathway pflv04137   Mitophagy - animal pflv04140   Autophagy - animal pflv04144   Endocytosis pflv04150   mTOR signaling pathway pflv04210   Apoptosis pflv04218   Cellular senescence pflv04370   VEGF signaling pathway pflv04371   Apelin signaling pathway pflv04510   Focal adhesion pflv04540   Gap junction pflv04625   C-type lectin receptor signaling pathway pflv04810   Regulation of actin cytoskeleton pflv04910   Insulin signaling pathway pflv04912   GnRH signaling pathway pflv04916   Melanogenesis pflv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pflv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114559784 (hras)    04012 ErbB signaling pathway     114559784 (hras)    04370 VEGF signaling pathway     114559784 (hras)    04371 Apelin signaling pathway     114559784 (hras)    04068 FoxO signaling pathway     114559784 (hras)    04150 mTOR signaling pathway     114559784 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114559784 (hras)    04140 Autophagy - animal     114559784 (hras)    04137 Mitophagy - animal     114559784 (hras)   09143 Cell growth and death    04210 Apoptosis     114559784 (hras)    04218 Cellular senescence     114559784 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     114559784 (hras)    04540 Gap junction     114559784 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114559784 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114559784 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     114559784 (hras)    04912 GnRH signaling pathway     114559784 (hras)    04916 Melanogenesis     114559784 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114559784 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pflv04131]     114559784 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pflv04147]     114559784 (hras)    04031 GTP-binding proteins [BR:pflv04031]     114559784 (hras) Membrane trafficking [BR:pflv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     114559784 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     114559784 (hras) Exosome [BR:pflv04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    114559784 (hras)   Exosomal proteins of colorectal cancer cells    114559784 (hras) GTP-binding proteins [BR:pflv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     114559784 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  114559784 NCBI-ProteinID:  XP_028440476 LinkDB All DBs Position 8:complement(14797006..14812144) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggtgtgggcaagagtgcacttacc atccagctcatccagaaccactttgtggatgagtatgaccccaccatagaggactcgtac aggaaacaggttgtgattgacggggaaacctgcctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggtttcctctgt gtcttcgccatcaacaacaccaagtcttttgaggacattcaccagtacagagaacagatc aaacgtgtgaaggactcagacgatgttcccatggtgcttgtgggaaacaaatgtgacctc ccggcacgcacggtggacacaaggcaagcccaagaacttgcccgctcttacggcatccct tacatcgagacctctgccaaaacacgacagggagtagaggacgccttctacacactggtt agggagatcagacagcataagctgaggaagctgaacccacctgatgagagcggtcaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system