Perca flavescens (yellow perch): 114561920 Help Entry 114561920         CDS       T07494                                  Symbol rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism pflv  Perca flavescens (yellow perch) Pathway pflv04140   Autophagy - animal pflv04144   Endocytosis pflv04530   Tight junction Brite KEGG Orthology (KO) [BR:pflv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114561920 (rab8a)    04140 Autophagy - animal     114561920 (rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     114561920 (rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pflv04131]     114561920 (rab8a)    03036 Chromosome and associated proteins [BR:pflv03036]     114561920 (rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pflv04147]     114561920 (rab8a)    04031 GTP-binding proteins [BR:pflv04031]     114561920 (rab8a) Membrane trafficking [BR:pflv04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     114561920 (rab8a)  Autophagy   Other autophagy associated proteins     114561920 (rab8a) Chromosome and associated proteins [BR:pflv03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     114561920 (rab8a) Exosome [BR:pflv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114561920 (rab8a)   Exosomal proteins of other body fluids (saliva and urine)    114561920 (rab8a)   Exosomal proteins of colorectal cancer cells    114561920 (rab8a) GTP-binding proteins [BR:pflv04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     114561920 (rab8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB MMR_HSR1 Septin DUF3963 DUF6974 AAA_7 Tor_FN3_2nd Motif Other DBs NCBI-GeneID:  114561920 NCBI-ProteinID:  XP_028443883 LinkDB All DBs Position 9:17205866..17213500 Genome browser AA seq 206 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVERMVLG NKCDVNDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKKLEGN NPQGSSQGVKITEQPKKSSFFRCTLL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacttacgattacttgtttaaactacttttaatcggcgattcaggcgtcgga aagacctgtgtgctattccgattttcagaagatgccttcaactcaacgtttatctccact ataggtattgatttcaagatcagaacaatagaattagatggaaagaaaatcaagctacag atatgggatacggcaggacaggagaggttcaggaccatcacaacagcctactacagagga gccatgggcatcatgttagtctatgacattaccaatgagaagtcctttgacaacatcaag aactggatacggaatatagaagagcatgcctcagcagatgtggaaaggatggtccttggg aacaaatgtgatgtcaatgacaagcgacaggtgtccaaagaaagaggagagaagctggcg ctggagtatggtatcaagttcatggagaccagtgcaaaggcgaacatcaacgtcgagaat gcctttttaaccctcgccagagacatcaaagcaaaaatggacaagaagctggagggcaac aacccgcagggcagcagtcaaggagtaaagattacagaacaacccaagaagagcagtttc ttccgctgcacgctcctgtga

DBGET integrated database retrieval system