Perca flavescens (yellow perch): 114568095 Help Entry 114568095         CDS       T07494                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism pflv  Perca flavescens (yellow perch) Pathway pflv04382   Cornified envelope formation pflv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pflv00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     114568095  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114568095  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pflv04147]     114568095 Exosome [BR:pflv04147]  Exosomal proteins   Exosomal proteins of microglial cells    114568095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH NNH2 Motif Other DBs NCBI-GeneID:  114568095 NCBI-ProteinID:  XP_028453280 LinkDB All DBs Position 14:complement(14423025..14425044) Genome browser AA seq 100 aa AA seqDB search MPSELETAMESLIKVFHRYASRDGRNGTLSRRELRELMENELSNFLQSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQMHMKKMGKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaaacagcaatggagtcacttatcaaggtgttccaccggtacgcc tctagggacggtcggaacggcacactcagccggcgagagcttagagagttgatggagaac gagctgtctaacttcctccagtctcagaaggaccctgccgctgtagacaaaatcatgaag gacctggacaccaacggtgacggccaggtggactttgaggagtttgtttctctggttgtt ggactttccattgcctgtgagcagtgctatcagatgcacatgaagaagatggggaagaag taa

DBGET integrated database retrieval system