Perca flavescens (yellow perch): 14048227 Help Entry 14048227          CDS       T07494                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism pflv  Perca flavescens (yellow perch) Pathway pflv00190   Oxidative phosphorylation pflv01100   Metabolic pathways Module pflv_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pflv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     14048227 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pflv03029]     14048227 (ND4L) Enzymes [BR:pflv01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      14048227 (ND4L) Mitochondrial biogenesis [BR:pflv03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     14048227 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  14048227 NCBI-ProteinID:  YP_007024808 UniProt:  K4JCL2 LinkDB All DBs Position MT:10067..10363 Genome browser AA seq 98 aa AA seqDB search MTPVHFAFSSAFILGLTGLAFHRTHLLSALLCLEGMMLSLFIALSLWTLQLDSTNFSAAP MLLLAFSACEASAGLALLVATARTHGTDRLQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaccccagttcactttgctttctcatcagccttcatcctaggactaacaggcctggca ttccaccgcacccatcttctctccgctcttttatgtctggaaggaataatgctttctcta tttattgccctctccctttgaactctgcaattagactccacaaacttctcagcagctcct atacttctattggcattttcagcatgcgaagcaagcgcaggccttgcccttctcgtagcc acagcccgaacccacggaaccgaccgattacaaaaccttaatctcctacaatgctaa

DBGET integrated database retrieval system