Pseudomonas fluorescens UK4: HZ99_19785 Help Entry HZ99_19785        CDS       T03319                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism pfn  Pseudomonas fluorescens UK4 Brite KEGG Orthology (KO) [BR:pfn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pfn03110]     HZ99_19785 Chaperones and folding catalysts [BR:pfn03110]  Protein folding catalysts   Protein disulfide isomerase    HZ99_19785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 DSBA Thioredoxin_2 Thioredoxin_4 Glrx-like SH3BGR Motif Other DBs NCBI-ProteinID:  AIG04311 LinkDB All DBs Position 4324730..4324984 Genome browser AA seq 84 aa AA seqDB search MSQVVVYSSDYCPYCMRAKQLLQSKQVAFDEIKVDGKPAVRAEMVQKAGRTSVPQIWIGT KHIGGCDDLYALERAGKLDALLHV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaggttgtcgtttattccagcgattattgcccttattgcatgcgagctaagcag ttgctccaaagcaaacaggttgccttcgacgagatcaaggtcgatggcaagcctgcggtg cgtgccgagatggtccagaaggcggggcgcacttctgtgccgcaaatctggatcgggacc aagcacatcggtggatgcgacgacctgtacgccctggagcgcgccggtaaattggacgcg ctgcttcacgtctga

DBGET integrated database retrieval system