Pseudomonas fluorescens Pf0-1: Pfl01_0438 Help Entry Pfl01_0438        CDS       T00283                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism pfo  Pseudomonas fluorescens Pf0-1 Pathway pfo01100   Metabolic pathways pfo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pfl01_0438    00074 Mycolic acid biosynthesis     Pfl01_0438   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pfl01_0438 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Decorin_bind Motif Other DBs NCBI-ProteinID:  ABA72182 UniProt:  Q3KJ74 LinkDB All DBs Position complement(497452..497706) Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELDPARVSLESNLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKSVRTVSDVVEAVYRLVQPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaactcgtgacgacatcttcaacaccctgcgcgatgccctggtcgagttgttcgaa ctggacccggcccgcgtgagcctggaatccaacctgtatcaggatctggaaatcgacagc atcgacgccgtcgacctgatcgatcacatcaagcgccagaccggcaagaaaatcgccgcc gaggagttcaagtcggtgcgcaccgtcagcgacgtggtcgaggcggtctaccgtctggtt caaccggcggcatga

DBGET integrated database retrieval system