Pseudomonas fluorescens Pf0-1: Pfl01_1122 Help Entry Pfl01_1122        CDS       T00283                                  Name (GenBank) cell division protein   KO K05589   cell division protein FtsB Organism pfo  Pseudomonas fluorescens Pf0-1 Brite KEGG Orthology (KO) [BR:pfo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfo03036]     Pfl01_1122 Chromosome and associated proteins [BR:pfo03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Pfl01_1122 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 Csm1_N YabA SlyX Motif Other DBs NCBI-ProteinID:  ABA72865 UniProt:  Q3KH91 LinkDB All DBs Position 1300227..1300505 Genome browser AA seq 92 aa AA seqDB search MRSPYWLFLVLLLLLAGLQYRLWVGNGSLAQVAELNQQIADQHAENEALLERNRVMDAEV SELKKGMETVEERARHELGMVKDGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccttactggttgtttctcgtcttgctcttgctgctggccggtctgcagtac cgcctgtgggtgggcaatggcagtctggcgcaagtcgccgaactgaatcagcaaattgct gatcaacacgccgagaacgaagccttgctggagcgcaaccgagtgatggacgctgaagtc agcgagttgaagaaaggcatggagaccgttgaagagcgggctcgtcacgaattgggcatg gtcaaggacggcgaaaccctttaccagttggcccaatga

DBGET integrated database retrieval system