KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1567
Entry
Pfl01_1567        CDS       T00283                                 
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo02020  Two-component system
pfo02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pfl01_1567
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Pfl01_1567
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pfo02022]
    Pfl01_1567
   02035 Bacterial motility proteins [BR:pfo02035]
    Pfl01_1567
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pfl01_1567
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Pfl01_1567
Two-component system [BR:pfo02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Pfl01_1567
Bacterial motility proteins [BR:pfo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Pfl01_1567
SSDB
Motif
Pfam: CheB_methylest Response_reg XPC-binding
Other DBs
NCBI-ProteinID: ABA73310
UniProt: Q3KFZ6
LinkDB
Position
1757585..1758721
AA seq 378 aa
MAVKVLVVDDSGFFRRRVSEILSADPSIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQ
LLCEKVHSISRSNRRFSAYSAPAPAAAPTPAPIPAAAPSSFGSHSAPARPAPAPAPTRAP
AASASSPAPKRKNYKLVAIGTSTGGPVALQRVLTQLPASFPAPIVLIQHMPAAFTKAFAE
RLDKLCRISVKEAEDGDILRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPCVDITF
GSAAKSYSDKVLAVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKADLA
DAVYSLDDIGKHIVEACV
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcagtcaaagtcctggtggtggacgattcgggttttttccgccgccgcgtctcggaa
attctttcagcggatccgagcatccaggttgtcggcacggcaaccaacggtaaagaggcg
atcgatcaggccctggccctcaagccggacgtgatcaccatggactacgagatgccgatg
atggatggcatcacggccgtgcggcacatcatgcagcgctgcccgaccccggtgttgatg
ttctcctcgctgacgcacgaaggcgcccgggtcaccctggatgcgctggatgccggcgcg
gtggatttcctgccgaagaatttcgaagacatctcccgcaatccggagaaggtcaagcaa
ctgctgtgcgagaaggtgcacagcatctcgcgcagcaaccgtcgtttcagtgcctacagt
gcgccggcgcctgccgctgcacctacgcctgcaccgattccggcagcagcgccgtcgagc
tttggcagccacagcgctccggcccgtccggctcctgcgcctgcaccgactcgcgcgcca
gcggccagcgcttcgtcgccagcgccgaaacgcaagaactacaagctcgtggcgattggt
acatcgaccggcggcccggtagcgctgcaacgggttctgactcaattgccggccagcttc
ccggcgccgatcgtgctgatccagcacatgccggcggccttcaccaaggccttcgccgaa
cgcctggacaagctatgccgcatcagcgtcaaggaagccgaggatggcgacatcctgcgt
ccgggcctggcgctgctggcaccgggtggcaagcagatgatgatcgacggccgaggcgca
gtgaaaatcttgccgggcgacgagcgtctgaactacaagccgtgcgtggacatcaccttc
ggttccgcagccaaatcctacagcgacaaagttctggcggtcgtactgaccggcatgggc
gccgacggccgtgaaggcgcacgcctgctcaagcagggcggcagcacggtctgggcccag
gatgaagccagttgcgtgatctacggcatgccgatggccatcgtcaaggctgacctcgcc
gatgcggtgtacagcctggacgatatcggcaagcacatcgtcgaggcgtgcgtctga

DBGET integrated database retrieval system