KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3208
Entry
Pfl01_3208        CDS       T00283                                 
Name
(GenBank) conserved hypothetical protein
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pfl01_3208
SSDB
Motif
Pfam: AAA_3 AAA_lid_2 bpMoxR AAA_5 MCM AAA Sigma54_activat RuvB_N Mg_chelatase AAA_16
Other DBs
NCBI-ProteinID: ABA74946
UniProt: Q3KBA8
LinkDB
Position
3687220..3688179
AA seq 319 aa
MEHREALLALRTFLSTQILGQEKLIERLLIALLADGHMLVEGAPGLAKTKAIKELAEGIE
AQFHRIQFTPDLLPADITGTEIYRPETGSFVFQQGPIFHNLVLADEINRAPAKVQSALLE
AMAERQVSVGRSTYELSPLFLVMATQNPIEQEGTYPLPEAQLDRFLMHVKMGFPDAAVER
RILQQARGEALNGETKPERRVSQQAIFAARKEILGLYMADAVEEYLVQLVMATRNPAKFD
PEMAEWIAYGASPRGSIALDRCARAHAWLAGRDFVSPEDIQAVLFDVLRHRIILSFEAEA
AGIDQDRVVQRILDVVAVA
NT seq 960 nt   +upstreamnt  +downstreamnt
atggaacatcgtgaagcgctgctggcgctgcgaacctttctttcaacgcagattctcggc
caggaaaaactcatcgagcgcttgctcatcgccctgctcgccgacggccacatgctggtc
gaaggcgctccaggtctggccaagaccaaagcgatcaaagagctcgccgagggcatcgaa
gcccagttccatcgcatccagttcaccccggacctgctgccggccgacatcaccggcacc
gagatctatcgcccggaaaccggcagcttcgtgttccagcaaggccctatcttccacaac
ctggtgctggcggacgaaatcaaccgcgccccggccaaggttcagtcggcgttgctcgaa
gcgatggccgaacgtcaggtcagtgtcgggcgtagcacttacgagttatcgccgctgttt
ctggtgatggccacgcagaacccgatcgaacaggaaggcacctatccgctgcccgaagcc
cagctcgaccgcttcctgatgcacgtgaaaatgggtttcccggacgcggccgtcgaacgc
cggatcctgcaacaggcccggggcgaagccctgaacggcgaaaccaagcccgaacgccgg
gtcagccagcaggcgatcttcgccgcgcgcaaggaaatcctcggcctgtacatggcggac
gccgtggaggaatacctggtgcaactggtcatggccacacgcaacccggccaagttcgac
ccggaaatggccgaatggatcgcctacggcgccagcccgcgtggctccattgccctcgac
cgctgcgcccgcgcccacgcctggctggccggtcgcgacttcgtcagcccggaagacatc
caggctgtgctgttcgacgtgttgcgtcaccgcatcattctgtcgttcgaggccgaagcc
gctggcatcgaccaggatcgggtggtgcaacggattctcgacgtcgtagccgtcgcttga

DBGET integrated database retrieval system