Pseudomonas fluorescens Pf0-1: Pfl01_4156 Help Entry Pfl01_4156        CDS       T00283                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pfo  Pseudomonas fluorescens Pf0-1 Pathway pfo01100   Metabolic pathways pfo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pfl01_4156 (acpP)    00074 Mycolic acid biosynthesis     Pfl01_4156 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pfl01_4156 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  ABA75893 UniProt:  Q3K8L1 LinkDB All DBs Position complement(4693743..4693979) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggtgttaaagaa gaagaagtggtcaacaccgcttccttcgtagaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gagaagatcactactgtacaagctgcaatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system