Pseudomonas fluorescens Pf0-1: Pfl01_5436 Help Entry Pfl01_5436        CDS       T00283                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism pfo  Pseudomonas fluorescens Pf0-1 Brite KEGG Orthology (KO) [BR:pfo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfo03036]     Pfl01_5436 Chromosome and associated proteins [BR:pfo03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Pfl01_5436 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB ADIP TPR_MLP1_2 Motif Other DBs NCBI-ProteinID:  ABA77173 UniProt:  Q3K4Y1 LinkDB All DBs Position 6103778..6103987 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLITRVEQLKSQNALLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaactgctgattacccgagtc gagcaactaaagagtcaaaatgcactcttacttgctcaggaaaagacctggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system