Poecilia formosa (Amazon molly): 103129462 Help Entry 103129462         CDS       T07984                                  Symbol cd59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism pfor  Poecilia formosa (Amazon molly) Brite KEGG Orthology (KO) [BR:pfor00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfor04147]     103129462 (cd59)    04090 CD molecules [BR:pfor04090]     103129462 (cd59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pfor00537]     103129462 (cd59) Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103129462 (cd59)   Exosomal proteins of other body fluids (saliva and urine)    103129462 (cd59)   Exosomal proteins of colorectal cancer cells    103129462 (cd59) CD molecules [BR:pfor04090]  Proteins   103129462 (cd59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pfor00537]  Antigens   103129462 (cd59) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  103129462 NCBI-ProteinID:  XP_007540635 Ensembl:  ENSPFOG00000006094 UniProt:  A0A087XJP7 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MKRSLVICLLVCSSLVGLGSAIRCYSCKDYTGSCTKQRDCSYDDACLTLVERGGMTYRKC LKYTECERSRLAQMFPQVSSFTFRCCNSDLCNSAPSSAAGSVIGLLASVLVMWWCVH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaagcgctccctggtgatctgcctactggtctgctcctctctggtcggactcgggtcc gccatccgctgctacagttgtaaggactacaccggcagctgcaccaagcagcgggactgc agctatgacgacgcctgcctcaccctcgtcgagagaggtgggatgacctacagaaagtgt ctgaagtacacagagtgtgagcggagccgcctggcccagatgttcccccaggtgtccagc ttcaccttcaggtgctgcaactcggacctgtgtaactccgccccctcgtctgccgcgggc tctgtgattggcctgctggcctccgtgctggtcatgtggtggtgtgtccactga

DBGET integrated database retrieval system