Poecilia formosa (Amazon molly): 103130110 Help Entry 103130110         CDS       T07984                                  Symbol dpy30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism pfor  Poecilia formosa (Amazon molly) Brite KEGG Orthology (KO) [BR:pfor00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfor03036]     103130110 (dpy30) Chromosome and associated proteins [BR:pfor03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      103130110 (dpy30)     MLL-HCF complex      103130110 (dpy30)     MLL3/MLL4 complex      103130110 (dpy30) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 Motif Other DBs NCBI-GeneID:  103130110 NCBI-ProteinID:  XP_007541481 Ensembl:  ENSPFOG00000018184 UniProt:  A0A087YJS8 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MADDHTDPDQSMEGHTPVSENPHAEFGLTENLQRTVENEKATAEKLSKQKVDLQALPTRA YLDQTVVPILLQGLSVLAKERPPNPIEYLAAFLLKNKSQFEERS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcggatgatcacacagacccagaccagtccatggagggacacacacctgtttctgaa aaccctcatgcggagttcggcctgacggagaacctgcagcggacggtggagaacgagaag gcgactgcggagaagctgtccaagcagaaggtggacctgcaggcgctgccgactcgggcc tacctggaccagaccgtggttcccatcctgctgcagggcctatccgtcctggccaaggag aggcctcccaaccctattgaatatctggcggcgttcctgctgaagaacaaatcccagttc gaggagcggagctaa

DBGET integrated database retrieval system