Poecilia formosa (Amazon molly): 103130674 Help Entry 103130674         CDS       T07984                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04060   Cytokine-cytokine receptor interaction pfor04218   Cellular senescence pfor04620   Toll-like receptor signaling pathway pfor04621   NOD-like receptor signaling pathway pfor04622   RIG-I-like receptor signaling pathway pfor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pfor00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103130674  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103130674  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103130674    04621 NOD-like receptor signaling pathway     103130674    04622 RIG-I-like receptor signaling pathway     103130674  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103130674  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pfor04052]     103130674    00536 Glycosaminoglycan binding proteins [BR:pfor00536]     103130674 Cytokines and neuropeptides [BR:pfor04052]  Cytokines   Chemokines    103130674 Glycosaminoglycan binding proteins [BR:pfor00536]  Heparan sulfate / Heparin   Chemokines    103130674 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 DUF4969 Motif Other DBs NCBI-GeneID:  103130674 NCBI-ProteinID:  XP_007542195 Ensembl:  ENSPFOG00000019630 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKKISIITLSVLIFLSFLATSKGMSLRSLGVELHCRCIQTESRPIGRHIEKVELIPANSH CEETEIIATLKKDGQEVCLDPEAPWVKKVIQRIMANKKR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaagaaaatcagcattattaccctctctgtcttaatcttcttgtccttcctcgccacc agcaaaggaatgagtctgagaagcttaggagtggagctgcactgtcgctgcatccagact gagagcagacccatagggcgccacatagagaaagtggagctgattcctgccaactctcac tgcgaggagaccgagatcattgccactctaaaaaaagatggccaagaagtttgcctggac cctgaggctccatgggtcaagaaagtaattcagaggatcatggcaaacaagaaacgatga

DBGET integrated database retrieval system