Poecilia formosa (Amazon molly): 103131526 Help Entry 103131526         CDS       T07984                                  Name (RefSeq) ras-related protein R-Ras2-like   KO K07830   Ras-related protein R-Ras2 Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04010   MAPK signaling pathway pfor04137   Mitophagy - animal pfor04140   Autophagy - animal pfor04218   Cellular senescence pfor04371   Apelin signaling pathway pfor04625   C-type lectin receptor signaling pathway pfor04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pfor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103131526    04371 Apelin signaling pathway     103131526  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103131526    04137 Mitophagy - animal     103131526   09143 Cell growth and death    04218 Cellular senescence     103131526   09142 Cell motility    04810 Regulation of actin cytoskeleton     103131526  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103131526  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfor04147]     103131526    04031 GTP-binding proteins [BR:pfor04031]     103131526 Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103131526   Exosomal proteins of bladder cancer cells    103131526 GTP-binding proteins [BR:pfor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103131526 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  103131526 NCBI-ProteinID:  XP_007543255 Ensembl:  ENSPFOG00000008890 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSGEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKVCTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSFHEVQKFHTQILRVKDRDDFPMVLIGN KADLEQHRVISREDAQAFARENKIHYMEASAKNRYNVDEAFMELVQIIRRFQEMESPPPP TQQTGKQNSRGCPCVIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtggggaagaagagagattcaaactggtggttgtgggaggaggtggagtgggcaag agcgccctgaccatccagttcatccagtcctactttgtgtcggactacgaccccaccatt gaagactcctataccaaggtgtgcactgtggatggcaaggagactcggctagacattcta gatacagcaggccaggaggagtttggtgccatgagggagcagtacatgcggtctggggaa ggcttcttactggtgtttgctctcaacgaccggggcagttttcatgaggtccagaagttc cacacccagatcctgagggtaaaagaccgagacgactttcccatggtgctgattggaaac aaggctgacctggagcagcatagagtgatctccagggaggacgctcaggcgtttgccaga gagaacaagatccactacatggaagcttctgccaagaatcgctacaatgtggatgaagct ttcatggagctggtgcagatcatcagacggtttcaggagatggagagtcctcctcctcca actcaacaaactgggaaacagaacagtcgtggctgtccctgtgtcatcctgtag

DBGET integrated database retrieval system