Poecilia formosa (Amazon molly): 103137101 Help Entry 103137101         CDS       T07984                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pfor00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     103137101  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfor03036]     103137101    03400 DNA repair and recombination proteins [BR:pfor03400]     103137101 Chromosome and associated proteins [BR:pfor03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      103137101 DNA repair and recombination proteins [BR:pfor03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      103137101 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone DUF7229 CCDC-167 ZapG-like Motif Other DBs NCBI-GeneID:  103137101 NCBI-ProteinID:  XP_007550717 Ensembl:  ENSPFOG00000016125 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MSVDKEETRQRLKAAVHYTVGRLCQKIGEDHRREFSRQTIAAIAETTFRECDIFAKDLEA FARHAKRSTVSSEDVKLLARRSSALSNHIQNKSEELAQEQRDSRKKSTVKRKSRDTEEES RE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtcagttgacaaagaggaaactcgtcagaggttgaaggcagcggttcattacacggtg ggtcggttgtgtcagaagatcggagaggaccaccggagggagttcagccgacagaccata gcagccatagcggaaacgacattcagggagtgcgacatctttgccaaggatctggaagct tttgccagacacgccaaaagaagcacggtgtcttcagaggatgtaaaacttctagcccgc cgcagtagtgctctgtccaaccacatacaaaataaaagtgaagaactggcccaggagcag agagattccagaaagaagagtacagtgaagaggaagagcagagacaccgaggaggagagc agagaatga

DBGET integrated database retrieval system