Poecilia formosa (Amazon molly): 103137321 Help Entry 103137321         CDS       T07984                                  Symbol brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04810   Regulation of actin cytoskeleton pfor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pfor00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103137321 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103137321 (brk1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  103137321 NCBI-ProteinID:  XP_007551087 Ensembl:  ENSPFOG00000016921 UniProt:  A0A087YG29 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctggccaggaagatcccgtacagagagagattcatcaagattgggcaaatcgagag tacatagaagtgattactagcagcattaagaaaattgctgacttcctcaactcgttcgat atgtcttgtcggtctcgtctggccaccctcaacgaaaagctaacggcgttggagagaagg attgaatacatagaggccagagtgaccaaaggagagaccctgacctag

DBGET integrated database retrieval system