Poecilia formosa (Amazon molly): 103138302 Help Entry 103138302         CDS       T07984                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04081   Hormone signaling pfor04144   Endocytosis pfor04150   mTOR signaling pathway pfor04270   Vascular smooth muscle contraction pfor04310   Wnt signaling pathway pfor04350   TGF-beta signaling pathway pfor04510   Focal adhesion pfor04520   Adherens junction pfor04530   Tight junction pfor04621   NOD-like receptor signaling pathway pfor04625   C-type lectin receptor signaling pathway pfor04810   Regulation of actin cytoskeleton pfor05100   Bacterial invasion of epithelial cells pfor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pfor00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103138302    04350 TGF-beta signaling pathway     103138302    04150 mTOR signaling pathway     103138302   09133 Signaling molecules and interaction    04081 Hormone signaling     103138302  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103138302  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103138302  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfor04131]     103138302   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfor04147]     103138302    04031 GTP-binding proteins [BR:pfor04031]     103138302 Membrane trafficking [BR:pfor04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103138302 Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103138302   Exosomal proteins of other body fluids (saliva and urine)    103138302   Exosomal proteins of colorectal cancer cells    103138302   Exosomal proteins of bladder cancer cells    103138302 GTP-binding proteins [BR:pfor04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103138302 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103138302 NCBI-ProteinID:  XP_007552505 Ensembl:  ENSPFOG00000019065 UniProt:  A0A087YMC2 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDDHTRRELAKMKQEPVKPEDGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKSNKCVLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaattaggaaaaagctggttatagtgggagatggagcctgtgggaagacctgc ctgctcattgtgttcagcaaggaccagtttcctgaagtctatgtgcccacagtgtttgag aactacgtcgctgacattgaagttgacggaaaacaggttgaattagcgctctgggacaca gcaggtcaagaggactatgaccgactccgcccactctcttatccagacactgatgtcata ctcatgtgcttctccatcgacagcccagacagtcttgagaacatccctgagaagtggacc cccgaggtgaaacacttctgccccaacgttcccatcatactggtgggaaataaaaaggat ttgcgtaacgatgatcacactcggagggagctagctaaaatgaagcaggaacccgtgaaa ccagaagatggccgggatatggccaacaggatcggtgccttcggatacatggagtgctct gcaaaaacaaaggatggcgtgagggaagtgttcgagatggccaccagggctgcactacag gccaggcggggaaagaagagcaataaatgcgtcctactgtaa

DBGET integrated database retrieval system