Poecilia formosa (Amazon molly): 103138544 Help Entry 103138544         CDS       T07984                                  Name (RefSeq) claudin-19-like   KO K06087   claudin Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor03272   Virion - Hepatitis viruses pfor04382   Cornified envelope formation pfor04514   Cell adhesion molecules pfor04530   Tight junction Brite KEGG Orthology (KO) [BR:pfor00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     103138544  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     103138544  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     103138544  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103138544  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pfor03037]     103138544    04147 Exosome [BR:pfor04147]     103138544    04515 Cell adhesion molecules [BR:pfor04515]     103138544 Cilium and associated proteins [BR:pfor03037]  Other cilia and associated proteins   Stereociliary proteins    103138544 Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    103138544   Exosomal proteins of colorectal cancer cells    103138544 Cell adhesion molecules [BR:pfor04515]  Immunoglobulin superfamily   L1 family    103138544 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF4064 DUF6535 MFS_1 Motif Other DBs NCBI-GeneID:  103138544 NCBI-ProteinID:  XP_007552840 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MASSGLQIVGFLLSLVGVSATIAATFMVEWGKESQAKHRTYDGLWMSCSGTSERATCENY KYLLKLPIEVQVTRALILVSLFLSAMALIVSILGMKCTRFMDAMPQSKVKAAVCGGGLFI LAGILTIIVTSWYVSRMVEVNEKAHRLQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccagctctggactgcagatcgttggttttctcctctccttagttggagtctctgct actattgccgctactttcatggtcgagtggggaaaggagagtcaagcaaaacaccgcacc tatgacggtctgtggatgtcctgcagcggcacctccgagagggccacctgcgaaaattac aagtatctactgaagctcccaattgaggtccaggtcactagagcactgattctggtcagc ctcttcctctccgccatggcgctgattgtctccatactgggaatgaagtgcactcgcttc atggatgccatgccacagagcaaagtcaaagcagctgtctgcggaggagggctgttcata ctcgctggtatcttgaccatcattgttacctcctggtacgtcagtaggatggttgaggtc aacgaaaaggcacatcgactccaaaagtaa

DBGET integrated database retrieval system