Poecilia formosa (Amazon molly): 103140794 Help Entry 103140794         CDS       T07984                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04382   Cornified envelope formation pfor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pfor00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103140794  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103140794  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfor04147]     103140794 Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of microglial cells    103140794 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 Nop5_N EF-hand_8 CRISPR_Cas9_WED DEK_C Motif Other DBs NCBI-GeneID:  103140794 NCBI-ProteinID:  XP_007556150 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MTELEKSMESLITVFHRYAKEGGNKTTLSKKELKKLMEKELPNFLTTQKNPDTVSSIIKD LDQNKDDELDFEEFVPFVAGLTIACEKHYALHHENKGKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaccgagttggagaaatccatggagtccctgatcacggtgtttcaccgttacgccaag gaaggtggcaataaaacgaccctgagcaagaaggagctgaaaaagctgatggagaaagag ttgcccaacttcttaacaacccagaaaaaccccgacacggtgtcgagcatcatcaaggat ctggaccagaacaaggacgatgagctggactttgaggaatttgttcccttcgtcgctgga ctgacaatcgcctgtgaaaagcattacgctttgcaccacgaaaacaagggcaagaagtga

DBGET integrated database retrieval system