Poecilia formosa (Amazon molly): 103140966 Help Entry 103140966         CDS       T07984                                  Symbol stra13 Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pfor00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     103140966 (stra13)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pfor03400]     103140966 (stra13) DNA repair and recombination proteins [BR:pfor03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      103140966 (stra13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  103140966 NCBI-ProteinID:  XP_007556409 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MAEKEEEVCFKKETVSKLLCSSFKEDKTRLGSDATLLMREMLKVFVQEAALRSLKQAEAE DCNRIEIEHFEKILPQLLLDF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcggagaaagaggaagaagtctgcttcaaaaaggaaaccgtgagcaaactcctgtgc agttcctttaaagaggacaaaaccagattaggcagtgatgctacgctactcatgagagaa atgctgaaagtgtttgtgcaagaggccgctttgagatcgctgaaacaagctgaagctgag gattgcaaccgaattgagattgagcattttgaaaagatcctgcctcagctgcttctggat ttttag

DBGET integrated database retrieval system