Poecilia formosa (Amazon molly): 103144481 Help Entry 103144481         CDS       T07984                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04382   Cornified envelope formation pfor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pfor00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103144481  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103144481  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfor04147]     103144481 Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of microglial cells    103144481 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH DEK_C Motif Other DBs NCBI-GeneID:  103144481 NCBI-ProteinID:  XP_007561550 Ensembl:  ENSPFOG00000009404 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSDLETAMELLIVVFHRYASKDGRAGTLSRRELRQLMENELSNFLKSQKDPGAIDKIMK DLDANGDGQVDFEEFVALVVGLSVACEQCYKMHKGLK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccctctgacctggaaacagcaatggagctgctcatcgtggtgttccaccgttacgcc tccaaggacggccgagcagggactctgagccggcgggagctcaggcagctgatggagaac gagctgtctaacttccttaagtctcagaaggaccctggtgccatcgataagataatgaag gacctggacgccaatggtgatggccaggtggactttgaggagtttgttgctctggtagtt ggactgtctgttgcctgtgagcagtgctataagatgcacaaaggactgaaatag

DBGET integrated database retrieval system