Poecilia formosa (Amazon molly): 103145971 Help Entry 103145971         CDS       T07984                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04621   NOD-like receptor signaling pathway pfor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pfor00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103145971  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103145971  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pfor03110]     103145971 Chaperones and folding catalysts [BR:pfor03110]  Protein folding catalysts   Protein disulfide isomerase    103145971 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin OST3_OST6 AhpC-TSA Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 Redoxin Thioredoxin_9 DIM1 Motif Other DBs NCBI-GeneID:  103145971 NCBI-ProteinID:  XP_007563715 Ensembl:  ENSPFOG00000024676 UniProt:  A0A096MC33 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MVREVKDLADFESILKEAGNKLVVVDFTATWCGPCKQIGPEFVKLSELPENKEVVFLKVD VDEAEDVSSHCKISCMPTFHFYKNGTKVFEFSGANLATLKSKLEELR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtccgggaagtgaaggatttagcagacttcgagtccatcctgaaggaggctggaaac aagctggtggtggtggacttcacagctacgtggtgcggtccctgcaaacaaattggccca gagtttgttaaactgtcggagctgcctgaaaacaaggaggtggttttcttgaaagtggac gtagatgaggctgaagatgtgagcagtcattgcaaaatttcatgcatgcctacattccac ttctacaagaatggcacgaaggtgttcgagttctctggagccaacctggcgacactaaag tccaaacttgaagagctgagatag

DBGET integrated database retrieval system