Poecilia formosa (Amazon molly): 103146647 Help Entry 103146647         CDS       T07984                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor03030   DNA replication pfor03410   Base excision repair pfor03420   Nucleotide excision repair pfor03430   Mismatch repair pfor03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pfor00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103146647 (pold4)    03410 Base excision repair     103146647 (pold4)    03420 Nucleotide excision repair     103146647 (pold4)    03430 Mismatch repair     103146647 (pold4)    03440 Homologous recombination     103146647 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pfor03032]     103146647 (pold4)    03400 DNA repair and recombination proteins [BR:pfor03400]     103146647 (pold4) DNA replication proteins [BR:pfor03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     103146647 (pold4) DNA repair and recombination proteins [BR:pfor03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       103146647 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      103146647 (pold4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 DNA_pol_alpha_N Motif Other DBs NCBI-GeneID:  103146647 NCBI-ProteinID:  XP_007564713 Ensembl:  ENSPFOG00000011260 UniProt:  A0A087XZM3 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MTTKRGLITDSFKVLKKTRRGGKRKKTPTPPPAQQEDVTTTVKEEEMQQLKQFDLDWRFG PCTGISRMQRWERAKLHGLNPPEEIKELLLQTLDDPEYSMSLWREYPF NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacaacaaaacgtggactgataaccgattcatttaaagtgctgaagaaaacaaggaga gggggaaagcgaaagaagactcccacgcctcctccagcacagcaagaagatgtcactaca actgtcaaagaggaggagatgcagcagctcaaacagtttgacctggactggagatttggg ccctgcacaggcatcagcagaatgcagaggtgggagagagcgaagcttcatggtctgaac ccacctgaggaaatcaaagagctgctgctgcaaacactcgatgatcctgagtactccatg agcctctggagagaatatccgttctga

DBGET integrated database retrieval system