Poecilia formosa (Amazon molly): 103151608 Help Entry 103151608         CDS       T07984                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04010   MAPK signaling pathway pfor04012   ErbB signaling pathway pfor04068   FoxO signaling pathway pfor04137   Mitophagy - animal pfor04140   Autophagy - animal pfor04144   Endocytosis pfor04150   mTOR signaling pathway pfor04210   Apoptosis pfor04218   Cellular senescence pfor04370   VEGF signaling pathway pfor04371   Apelin signaling pathway pfor04510   Focal adhesion pfor04540   Gap junction pfor04625   C-type lectin receptor signaling pathway pfor04810   Regulation of actin cytoskeleton pfor04910   Insulin signaling pathway pfor04912   GnRH signaling pathway pfor04916   Melanogenesis pfor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pfor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103151608    04012 ErbB signaling pathway     103151608    04370 VEGF signaling pathway     103151608    04371 Apelin signaling pathway     103151608    04068 FoxO signaling pathway     103151608    04150 mTOR signaling pathway     103151608  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103151608    04140 Autophagy - animal     103151608    04137 Mitophagy - animal     103151608   09143 Cell growth and death    04210 Apoptosis     103151608    04218 Cellular senescence     103151608   09144 Cellular community - eukaryotes    04510 Focal adhesion     103151608    04540 Gap junction     103151608   09142 Cell motility    04810 Regulation of actin cytoskeleton     103151608  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103151608   09152 Endocrine system    04910 Insulin signaling pathway     103151608    04912 GnRH signaling pathway     103151608    04916 Melanogenesis     103151608  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103151608  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfor04131]     103151608   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfor04147]     103151608    04031 GTP-binding proteins [BR:pfor04031]     103151608 Membrane trafficking [BR:pfor04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103151608  Endocytosis   Macropinocytosis    Ras GTPases     103151608 Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103151608   Exosomal proteins of colorectal cancer cells    103151608 GTP-binding proteins [BR:pfor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103151608 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 Motif Other DBs NCBI-GeneID:  103151608 NCBI-ProteinID:  XP_007571831 Ensembl:  ENSPFOG00000002595 LinkDB All DBs Position Unknown AA seq 174 aa AA seqDB search MLFFVVVLVHELKHLSVSFFLKDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTG EGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLPARTVDTRQAQELAR SYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQDCMSCRCVVS NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgcttttttttgttgttgttttggtgcatgaattgaaacatttgagtgtctcctttttt ctgaaggactcctaccggaagcaagtggtgatcgacggggagacatgcttgctggacatc ctggacactgcaggtcaggaggagtacagcgccatgagagatcagtatatgagaacagga gagggcttcctctgcgtctttgcaatcaacaacaccaagtcttttgaggacattcaccag tacagagaacagatcaagcgcgtgaaagactctgatgatgtacccatggtgcttgtggga aacaaatgtgacctcccagcacgcacagtggacacaaggcaagcccaggagcttgctcgc tcctacgggatcccttacattgagacctcggctaagacacgacagggagtggaggatgcc ttctacacactggtgagggaaataaggcagcacaagctgaggaagctgaacccacctgat gagagcggccaggactgtatgagttgcagatgtgtggtatcgtga

DBGET integrated database retrieval system