Poecilia formosa (Amazon molly): 103155894 Help Entry 103155894         CDS       T07984                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04010   MAPK signaling pathway pfor04068   FoxO signaling pathway pfor04081   Hormone signaling pfor04114   Oocyte meiosis pfor04140   Autophagy - animal pfor04150   mTOR signaling pathway pfor04810   Regulation of actin cytoskeleton pfor04910   Insulin signaling pathway pfor04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:pfor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103155894    04068 FoxO signaling pathway     103155894    04150 mTOR signaling pathway     103155894   09133 Signaling molecules and interaction    04081 Hormone signaling     103155894  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103155894   09143 Cell growth and death    04114 Oocyte meiosis     103155894   09142 Cell motility    04810 Regulation of actin cytoskeleton     103155894  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103155894    04914 Progesterone-mediated oocyte maturation     103155894  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pfor04052]     103155894 Cytokines and neuropeptides [BR:pfor04052]  Neuropeptides   Unclassified    103155894 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Toxin_8 Motif Other DBs NCBI-GeneID:  103155894 NCBI-ProteinID:  XP_007577841 Ensembl:  ENSPFOG00000022133 UniProt:  A0A096M678 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MARVPWTFSMLFLLVLHSPGASLAPNQHLCGSHLVDALYFICGERGFYNSPSRVHKRDLE NLLGFLAKRARAEERLRRVLAARDEPKVKRGIVEQCCHKPCSIHHLEDYCN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatggacattctccatgctgttcctgcttgtgctccactctccaggg gcctcgttggccccaaaccagcacctgtgtggctctcacctggtcgacgccctctacttc atctgtggggagcgaggattttacaacagtccgagccgagtccacaagcgggacctggag aatctgcttgggttcctggcgaaaagggctagagcggaggagcggctgcggagggttctg gctgcccgtgacgagcccaaggtgaagagaggcatcgtggagcagtgctgccataagccg tgcagcattcaccacctggaggactactgcaactga

DBGET integrated database retrieval system