KEGG   Pseudomonas fortuita: OZ911_00355
Entry
OZ911_00355       CDS       T10310                                 
Name
(GenBank) SulP family inorganic anion transporter
  KO
K03321  sulfate permease, SulP family
Organism
pfou  Pseudomonas fortuita
Brite
KEGG Orthology (KO) [BR:pfou00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfou02000]
    OZ911_00355
Transporters [BR:pfou02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   OZ911_00355
SSDB
Motif
Pfam: Sulfate_transp STAS STAS_2
Other DBs
NCBI-ProteinID: WAP63902
LinkDB
Position
complement(77064..78629)
AA seq 521 aa
MHRIIHLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYALIAGLPAEYGLYAAIV
PVLIACLWGSSWHLICGPTAAISIVLYASISPLAVAGSADYITLVLLLTLLGGIFQLLLG
LMRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMDLPSQATALKTVQDLASHAGEV
DLPSFILGLATVVIGVAFKLWRPRWPSLLISLMLVSLLAWLLPGYFGHVQRVAAFTGQLP
PFSPLPLLDLELMLRLLPSAVAVGMLGLVTSLSIARSLSARSEQLIDPDQEIRAQGLSNI
AGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFSALWVALFAVTGAGLIAHLPIPAMAGS
ILLICWGLVDHRAIRALFRVSRSEFLVMALTAAATLLLELQTAIYAGVLASLFFYLKRTS
RPRVQLSREGDADVLRVGGSIFFGAAHYLQVRLQRCQGPHVVIDARQVNFIDYSGVDMLH
REARRLRRLGGSLTLHRARPQVIEELQKLEGVELCPIRFEE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgcatcgcatcattcacctgctgcccttcctcacctggctcccgcgccaatcgggccgc
agcctgcgccaggacctgctggtcggcctgagcggtgccatcctcgccctgccacaatcc
atcgcctacgccctgattgccggcctgcccgccgaatacggcctgtacgccgccatcgtg
ccggtgctgatcgcctgcctgtggggctcgtcctggcacctgatctgcggccccaccgcc
gccatttccatcgtgctctacgccagcatcagcccgctggccgtggccggcagcgccgat
tacatcaccctggtactgttgctgaccttgctcggcggcatcttccagttgctgctcggg
cttatgcgctttggcgcgctggtcaatttcgtctcccactcggtagtgctcggcttcacg
ctgggggctgccatcgtcattgccttgggccaattgcccaacctgctgggcatggacctg
cccagccaggccacggcactgaaaaccgtacaggacctggccagccatgcaggggaggtc
gacctgccttcctttattctgggcctggccactgtcgtgatcggcgtagccttcaaactg
tggcgcccacgctggccgagcctgttgataagcctgatgctggtcagcctgctggcttgg
ctgttgccgggctactttggccatgtgcaaagggtggcggcgtttaccgggcaactccca
cccttcagcccgctgcctttgctggatctggaactgatgctgcgcctgctgcccagcgcc
gtggcggtaggcatgctggggctggtcaccagcctgtcgattgcccgctcgttgtcggca
cgttcagaacaactgatcgaccccgaccaggaaatccgcgcacagggcctgtcgaacatc
gccggtgcatttttctccggttacctgtctgccggttccttcacccgctcaggcctgagt
tatgaggcaggtgcccgctcgcccatggctggggtgttctcggcgctgtgggtggcgttg
tttgccgttaccggcgccggcctgatcgcgcacctgccgatacccgccatggctggcagc
attctgctgatctgctgggggttggtggaccatcgggcgattcgcgcgctgtttcgggtc
agccgctcggagtttctggtgatggcgctgacggcggcggcgacattgttgctggagttg
cagacggccatctatgcaggcgtgctggcttcgctgttcttttacctcaagcgcacgtca
cggccacgggtgcagctaagccgggaaggggacgcggatgtgttgcgggtgggcgggtcg
attttctttggtgcggcgcattacctgcaggtgcgcttgcagcgctgccaggggccgcat
gtagtgatcgatgcccggcaggtgaattttatcgattactcgggtgtggatatgttgcac
cgcgaagcgcggcggttgcggagattgggcgggagtttgaccctgcaccgggccaggccg
caggtgatcgaggaattgcagaagctggaaggggtggagttgtgtccgatccggtttgag
gagtga

DBGET integrated database retrieval system