Pseudomonas fortuita: OZ911_07260 Help Entry OZ911_07260       CDS       T10310                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfou  Pseudomonas fortuita Pathway pfou01100   Metabolic pathways pfou01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfou00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OZ911_07260 (acpP)    00074 Mycolic acid biosynthesis     OZ911_07260 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OZ911_07260 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Ribosomal_L50 Fas_alpha_ACP Motif Other DBs NCBI-ProteinID:  WAP65196 LinkDB All DBs Position 1606883..1607119 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNSHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtgaaggaa gaggaagtgactaacgagaagtccttcgtcgatgacctgggtgccgattcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaaaatcactaccgttcaagccgctatcgactacgtcaacagccacaaggcctaa

DBGET integrated database retrieval system