Pseudozyma flocculosa: PFL1_03392 Help Entry PFL1_03392        CDS       T03141                                  Name (RefSeq) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pfp  Pseudozyma flocculosa Pathway pfp04145   Phagosome pfp04148   Efferocytosis pfp04620   Toll-like receptor signaling pathway pfp05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pfp00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PFL1_03392    04148 Efferocytosis     PFL1_03392  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     PFL1_03392  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     PFL1_03392  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfp04131]     PFL1_03392   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfp04147]     PFL1_03392    04031 GTP-binding proteins [BR:pfp04031]     PFL1_03392 Membrane trafficking [BR:pfp04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     PFL1_03392  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     PFL1_03392   Macropinocytosis    Ras GTPases     PFL1_03392  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     PFL1_03392 Exosome [BR:pfp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PFL1_03392   Exosomal proteins of other body fluids (saliva and urine)    PFL1_03392   Exosomal proteins of colorectal cancer cells    PFL1_03392   Exosomal proteins of bladder cancer cells    PFL1_03392 GTP-binding proteins [BR:pfp04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     PFL1_03392 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  19317502 NCBI-ProteinID:  XP_007879100 UniProt:  A0A061H908 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVSLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVSPPSFENVRTKWWPEISHHAPNIPMILVGTKLDLR EDPETIAKLRDRRMQPISYAQGNQMARDIGGTKYLECSALTQKGLKGVFDEAIRSVLAPA PVKSKKKNNCMIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcagaccatcaaatgcgttgttgtcggagacggcgccgtcggcaagacatgcctcctg atctcgtacaccaccaatgcgttcccaggggagtacatccctaccgtcttcgacaactac tcggcgaacgtcatggtcgatggcaagcccgtcagccttggtctgtgggatactgcgggg caggaggactacgaccgactgcggccactgtcgtacccgcaaaccgacgtcttcctcatc tgcttttcgctggtgagcccgcccagctttgaaaacgtccgcaccaagtggtggcccgag atcagccaccatgcgcccaacatccccatgatcctcgtcggcaccaagctcgatctgcgc gaggaccccgagacgattgccaaactgcgggaccgaaggatgcagcccatctcatacgcc cagggcaaccagatggcgcgcgacattggcgggacaaagtacctcgaatgctccgccctc acgcaaaagggcctcaagggcgtttttgacgaggccatccggagtgtcttggcgccggca cccgtcaagtccaagaagaagaacaactgcatgattctctga

DBGET integrated database retrieval system