Pseudozyma flocculosa: PFL1_03414 Help Entry PFL1_03414        CDS       T03141                                  Name (RefSeq) hypothetical protein   KO K10991   DNA repair protein Swi5/Sae3 Organism pfp  Pseudozyma flocculosa Brite KEGG Orthology (KO) [BR:pfp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pfp03400]     PFL1_03414 DNA repair and recombination proteins [BR:pfp03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      PFL1_03414 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Swi5 DUF2959 Motif Other DBs NCBI-GeneID:  19317524 NCBI-ProteinID:  XP_007879122 UniProt:  A0A061HES2 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MIPAKQVSTPFKSPLAQSHSHTPPSQDDLEETKRQIESLQTKLGDADVDETIKRHVELLN EYNAVKDGCTKVFDRIAEIEAVPSSVVWMRYGLDKDD NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgattcccgccaagcaggtatcgacgcccttcaagtccccgctggcgcagtcgcacagc cacaccccgccatcgcaggacgacctcgaggagacgaagcggcagattgagtcgttgcag acgaaacttggggatgcagatgtcgacgagacgatcaagaggcatgttgagctgctcaac gagtacaatgccgtaaaggacggctgtaccaaggtctttgatcgcattgccgagatcgag gctgttccctcctcggtcgtctggatgcgttacggcctcgacaaggacgactag

DBGET integrated database retrieval system