Pseudozyma flocculosa: PFL1_05134 Help Entry PFL1_05134        CDS       T03141                                  Name (RefSeq) hypothetical protein   KO K08341   GABA(A) receptor-associated protein Organism pfp  Pseudozyma flocculosa Pathway pfp04136   Autophagy - other pfp04138   Autophagy - yeast pfp04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:pfp00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     PFL1_05134    04136 Autophagy - other     PFL1_05134    04139 Mitophagy - yeast     PFL1_05134  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfp04131]     PFL1_05134    04121 Ubiquitin system [BR:pfp04121]     PFL1_05134    03029 Mitochondrial biogenesis [BR:pfp03029]     PFL1_05134 Membrane trafficking [BR:pfp04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     PFL1_05134 Ubiquitin system [BR:pfp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    PFL1_05134 Mitochondrial biogenesis [BR:pfp03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     PFL1_05134 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  19319232 NCBI-ProteinID:  XP_007880855 UniProt:  A0A061H9C7 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MRSTFKNEHTFEKRKAEAERIRQKYPDRIPVICEKADRTDIPTIDKKKYLVPSDLTVGQF VYVIRKRIKLAPEKAIFIFVDEVLPATAALMSAIYEEHKDEDGFLYVSYSGENTFGHQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgaggtccactttcaagaacgagcacacgtttgagaaacgcaaggccgaggccgagcgc atccgccagaagtaccccgacaggatccctgtcatctgcgaaaaggccgaccgaaccgac atccctacaattgacaagaagaagtacctcgtgccatcagatctcacagtgggccagttt gtctatgtcatccgcaagaggatcaagctggcgcccgagaaggccatcttcatctttgtc gacgaggtactgcccgccaccgccgcgctgatgagcgcaatctacgaggagcacaaggac gaggacggtttcctctacgtcagctactcgggagagaacacctttggccaccaatga

DBGET integrated database retrieval system