Pseudozyma flocculosa: PFL1_05593 Help Entry PFL1_05593        CDS       T03141                                  Name (RefSeq) hypothetical protein   KO K12161   ubiquitin related modifier 1 Organism pfp  Pseudozyma flocculosa Pathway pfp04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:pfp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     PFL1_05593  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:pfp03016]     PFL1_05593    04121 Ubiquitin system [BR:pfp04121]     PFL1_05593 Transfer RNA biogenesis [BR:pfp03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     PFL1_05593 Ubiquitin system [BR:pfp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    PFL1_05593 SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Castor_Poll_mid DUF3290 TrkA_C ThiS-like TP6A_N Motif Other DBs NCBI-GeneID:  19319682 NCBI-ProteinID:  XP_007881319 UniProt:  A0A061H3A0 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MTAGDAKVTVHVELAGGTELLLAPPHQKKHTFQLPRTNQHGRQTDVADLIQHIRKNLVVE REELFVDGNTVRPGILVLINNGDWELEGEGDYVLQDGDEIVFISTLHGG NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgacggccggcgatgcaaaggtcacggtgcacgtcgagctggcggggggcaccgagctc ctccttgccccgcctcatcaaaagaagcataccttccagctgcccaggaccaaccagcac ggcaggcagaccgatgtcgcagacctcatccagcacatccgcaagaacctcgtcgtagag agggaggagctctttgtcgacggaaacacggtgcgccctgggatcctggtcctcatcaac aatggcgactgggagctcgagggcgagggcgactacgttcttcaggacggtgatgagatc gtcttcatcagcacgctccatggaggctga

DBGET integrated database retrieval system