Peribacillus frigoritolerans: L8956_09695 Help Entry L8956_09695       CDS       T08180                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism pfri  Peribacillus frigoritolerans Pathway pfri00030   Pentose phosphate pathway pfri00051   Fructose and mannose metabolism pfri00710   Carbon fixation by Calvin cycle pfri01100   Metabolic pathways pfri01110   Biosynthesis of secondary metabolites pfri01120   Microbial metabolism in diverse environments pfri01200   Carbon metabolism pfri01230   Biosynthesis of amino acids Module pfri_M00004   Pentose phosphate pathway (Pentose phosphate cycle) pfri_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:pfri00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     L8956_09695 (rpiB)    00051 Fructose and mannose metabolism     L8956_09695 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     L8956_09695 (rpiB) Enzymes [BR:pfri01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      L8956_09695 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  ULM98928 LinkDB All DBs Position 2016109..2016546 Genome browser AA seq 145 aa AA seqDB search MKVVIASDHGGINIRKEIISLLKEMNIEYEDMGCECSTSVDYPDYALPVAEKVAKGEVDR GILICGTGIGMSIAANKVKGIRCALVHDMFSAKATREHNDTNILAMGERVIGPGLARNIA KIWLTTPFEGGRHKNRINKIRTYEA NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagtcattgcttctgatcacggtggtataaatattcgtaaagagattatttct ctgttaaaagaaatgaatattgaatatgaagatatgggctgtgagtgcagtacatctgtt gactatccggattatgccttgccagtagctgaaaaggttgcaaaaggagaagtggaccgt gggatcttaatttgcggaacaggtattggaatgagcattgcagccaacaaagtaaaggga atacgttgtgcacttgtgcatgatatgtttagtgctaaggcaacgagagaacataacgat accaacatattagctatgggagagcgtgtgattggtccaggtctagctcgtaatattgca aaaatatggttaacaacaccttttgaaggtggtagacataaaaaccgtatcaataaaata agaacatatgaagcataa

DBGET integrated database retrieval system