Pseudomonas fluorescens SBW25: PFLU_0436 Help Entry PFLU_0436         CDS       T00899                                  Name (GenBank) Putative acyl carrier protein   KO K02078   acyl carrier protein Organism pfs  Pseudomonas fluorescens SBW25 Pathway pfs01100   Metabolic pathways pfs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PFLU_0436    00074 Mycolic acid biosynthesis     PFLU_0436   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PFLU_0436 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAI2794756 UniProt:  C3KBU7 LinkDB All DBs Position 1:complement(484220..484489) Genome browser AA seq 89 aa AA seqDB search MSDQHRLEHDIKMLIIEALGLEDIGVDDIGSEQTLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFTNVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccaacaccgccttgagcacgacataaagatgctgatcatcgaggccctgggc ctggaagacatcggcgtcgacgacatcggcagcgagcaaaccctgttcggcgaaggcctc ggcctggattcggtagacgccctggaattgggcctggcgatccagaaaaagtacggcatc aagatcgatgccgacgccaaggacacgcgcaatcacttcaccaacgtggccagccttgcg gcgttcgtcacggccagacaggcagcttga

DBGET integrated database retrieval system