Pseudomonas fluorescens SBW25: PFLU_3866
Help
Entry
PFLU_3866 CDS
T00899
Name
(GenBank) Putative pH adaptation potassium efflux protein
KO
K05561
multicomponent K+:H+ antiporter subunit D
Organism
pfs
Pseudomonas fluorescens SBW25
Brite
KEGG Orthology (KO) [BR:
pfs00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pfs02000
]
PFLU_3866
Transporters [BR:
pfs02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
PFLU_3866
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proton_antipo_M
NADHdeh_related
Proton_antipo_N
Motif
Other DBs
NCBI-ProteinID:
CAI2798062
UniProt:
C3JYC8
LinkDB
All DBs
Position
1:4261733..4263406
Genome browser
AA seq
557 aa
AA seq
DB search
MNQLIVAPILLPLLTAALMLMLGEKHRPLKARINLFSSMIGLGIAILLLYWTQKGGPGSI
GVYLPGNWQVPFGIVLVVDQLSALMLVLTGIIGVSALLFAMARWDRAGTSFHALFQIQMM
GLYGAFLTADLFNLFVFFEVLLAASYGLMLHGSGRARVSSGLHYIAINLLASSLFLIGAA
MIYGVTGTLNFADLALKIPLVPEADRGLLHAGAAILATAFLAKAGMWPLNFWLAPAYSSA
SAPVAAMFAIMTKVGVYTVLRLWTLLFSGQAGASALFGGDWLVYGGMATIVCAGLAMVAA
QRLERMASLSILVSAGILLSSVGFAQPSLTAGALFYLVSSTLALSALFLLAELIERSRSA
NDLPLDEEIDALPKAMESLHPRPGVNLDDEQKAVVGQVIPWTMAFLGLSFVACALLIIGM
PPLSGFIGKLSLLSALVNPLGLGVSVEKPIRPAAWGLVALLILSGLASLIAFARLGIQRF
WTPEERPSPLLRRYECVPIFFLLGLSILLTFKAEPLMRYTLGTAQSLNNPENYVMAVMAT
RPVPSPEAKTAALEVQP
NT seq
1674 nt
NT seq
+upstream
nt +downstream
nt
atgaatcaactgatcgtcgcaccgatcctgctgccgttgcttaccgccgccttgatgctg
atgctcggcgagaagcatcggccgctgaaagcgcgcatcaacctgttctcgagcatgatc
ggcctgggcatcgccattctgctgctgtactggacgcaaaaaggcggccccggctcgatt
ggcgtgtacctgccgggcaactggcaggtgccgttcggcattgtgctggtggtggaccaa
ctatcagccttgatgctggtgctcaccgggatcatcggcgtgagcgcgctgctgttcgcc
atggcccgctgggaccgtgccggcaccagcttccatgcgctgttccagatccagatgatg
ggcctctacggcgccttcctcacggccgacctgtttaacctgttcgtgttcttcgaggtg
ctgctggcggcgtcctatggcttgatgctgcacggttccggccgtgcgcgggtgtcatcg
gggctgcattacatcgcgatcaacctgctggcctcgtcactgttcctgattggtgcggcg
atgatctatggcgtcaccggcacgctgaactttgccgacctggcgctgaagatcccgctg
gtgccggaagccgatcgcggcctgctgcacgcgggtgcggcgatccttgcgacggcgttc
ctggcgaaagccggcatgtggccgctgaacttctggctggcccccgcctactcatcggcc
agcgcgccggtggcggcgatgtttgcgatcatgaccaaggtcggcgtgtacaccgtgttg
cgcctgtggaccctgttgttctccggccaggccggtgcgtcggcactgtttggcggcgat
tggctggtgtacggcggcatggccaccattgtctgcgccggtctggcgatggtggcggcg
cagcgcctggagcgcatggccagcttgagcatcctggtctcggccgggatcctgctgtcg
tcggtgggcttcgcccagccgagcctcaccgccggcgcgctgttctatctggtcagttcc
accttggccttgagcgcgctgttcctgctggccgaattgatcgagcgttcgcgctcggcc
aacgacctgccgctggatgaagagatcgatgcactgcccaaggccatggagtccctgcat
ccgcgccctggcgtcaacctcgatgacgaacagaaagccgtggtcggccaggtgattccc
tggaccatggcctttctgggcttgagttttgtcgcctgcgccctgctgattatcggcatg
ccgccgttgtccgggtttatcggcaagctcagcctgttgagcgcgctggtcaacccgctg
ggcctgggggtcagtgtcgagaagccgatccgcccggctgcctggggcctggtcgcactg
ctgatcctctccggcctggcctcgctgatcgcctttgcgcgtttgggcatccagcgcttc
tggaccccggaagagcgcccgtcgccgttgctgcgccgctatgagtgcgtgccgatcttc
ttcctgctgggcctgagcattctgctgaccttcaaggcagagccgctgatgcgctacacc
ctgggcaccgcccagagcctgaacaacccggaaaactacgtgatggcggtgatggcaacg
cgtcccgtacccagccctgaagccaagaccgccgcgctggaggtgcaaccatga
DBGET
integrated database retrieval system