Prevotella fusca: ADJ77_03670 Help Entry ADJ77_03670       CDS       T04032                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pfus  Prevotella fusca Pathway pfus00020   Citrate cycle (TCA cycle) pfus00720   Other carbon fixation pathways pfus01100   Metabolic pathways pfus01110   Biosynthesis of secondary metabolites pfus01120   Microbial metabolism in diverse environments pfus01200   Carbon metabolism pfus01210   2-Oxocarboxylic acid metabolism Module pfus_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pfus00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ADJ77_03670   09102 Energy metabolism    00720 Other carbon fixation pathways     ADJ77_03670 Enzymes [BR:pfus01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ADJ77_03670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_7 Fer4_9 Fer4_6 Fer4_10 Fer4_4 Fer4_16 Fer4_17 Fer4_15 Fer4_8 Fer4_3 Fer4_22 Chordopox_G2 Fer4_13 Fer4_18 Motif Other DBs NCBI-ProteinID:  AKU68934 UniProt:  A0A0K1NIL9 LinkDB All DBs Position 1:complement(897551..897784) Genome browser AA seq 77 aa AA seqDB search MSKMKGAIVVNTDRCKGCQLCVVACPKDVIALVQKKVNVHGYPYIEPARADDCIGCAACA TVCPDGCITVYRKKVEV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagatgaaaggtgccattgtagtaaacacagatcggtgcaaaggatgccagttg tgtgtcgttgcatgtccgaaagatgttattgcattggttcaaaagaaggtaaatgtccac ggatacccgtatattgagcctgcacgagctgatgactgtatcggctgtgctgcttgtgca acggtttgtcctgatggctgtattacagtctatcgtaagaaagtggaggtatga

DBGET integrated database retrieval system